zbio.net - main page Zbio.net > Calculations > Converters > Mass - moles (for proteins) Rambler's Top100  Russian version  Deutsche Version  Український варіант
MAIN PAGE · PROJECT · PROTOCOLS · PROGRAMS · LITERATURE · WEB · COMPANIES · MARKETPLACE · CLASSIFIED · FORUMS ·

Weight to Molar Quantity (for proteins)

 

    This program helps you to convert the weight (weight concentration) in the molar quantity (molar concentration) and vice versa.

       

       

     

    Protein molecular weight [kDa]:  
    "weight" --> "mole":
              
      molecules   
    "mole" --> "weight":
              
      molecules   

    Calculation of the molar concentration:
       in   

     

    Calculation of the weight from the molar concentration:
       in   

     


Zbio.net: http://zbio.net
e-mail: editor@zbio.net
seen: 371684

    Supplement

    Гость /09.01.2006 07:30/
    what the formula to convert the ng to pmol



    Гость /05.10.2006 03:34/
    Thanks!!! Very usefull site!!



    Гость /28.11.2006 00:09/
    Thanks, Very good
    Mahendran



    Гость /24.01.2007 20:15/
    Thank you Very much! your site is very usefull!!!!



    Гость /07.02.2007 05:44/
    Thank you so much, your site is very helpful.

    Ph.D student



    Гость /12.03.2007 13:48/
    N L P S D A T P V L D V T G K E L D P R L S Y R I I S T F W G A L G G D V Y L G K S P N S D A P C A N G V F R Y N S D V G P S G T P V R F I G S SS H F G Q G I F E D E L L N I Q F A I S T S K M C V S Y T I W K V G D Y D A S L G T M L L E T G G T I G Q A D S S W F K I V K S S Q F G Y N L L Y C P V T T T M T L P F S S D D Q F C L K V G V V H Q N G K R R L A L V K D N P L D V S F K Q V Q



    Гость /14.03.2007 11:33/
    MGVLLTQRTL LSLVLALLFP SMASMAMHVA QPAVVLASSR
    GIASFVCEYA SPGKATEVRV TVLRQADSQV TEVCAATYMM
    GNELTFLDDS ICTGTSSGNQ VNLTIQGLRA MDTGLYICKV
    ELMYPPPYYL GIGNGTQIYV IDPEPCPDSD QEPKSSDKTH
    TSPPSPAPEL LGGSSVFLFP PKPKDTLMIS RTPEVTCVVV
    DVSHEDPEVK FNWYVDGVEV HNAKTKPREE QYNSTYRVVS
    VLTVLHQDWL NGKEYKCKVS NKALPAPIEK TISKAKGQPR
    EPQVYTLPPS RDELTKNQVS LTCLVKGFYP SDIAVEWESN
    GQPENNYKTT PPVLDSDGSF FLYSKLTVDK SRWQQGNVFS
    CSVMHEALHN HYTQKSLSLS PG**K*



    Гость /14.03.2007 11:36/
    MGVLLTQRTLLSLVLALLFPSMASMAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQ
    VNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVV
    DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVS
    LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG**K*



    Гость /28.03.2007 21:06/
    MSSEGEIRTCFISARLPSWAGVRQGVAGTNVNGGVVGAPAQSGVLAYSRF
    VQQQQQQPGTAATGSVFRAVFPSVDLSAEVGMMRQALAELRQQLQELREV
    VEIQLRATASEAAEEEEEEEIVVDEEVAPGAGANTMEEEEDEMVLTMTVV
    GDPEPAGVEAQPPPPPTPESDPAVPATTTTPKRLSYGASKRSGPCAEDNV
    SGSGSGSGSGSGSGSGSGSGTVNQGAFEDCCLAYHSHIKWRLLRRAHSYQ
    RQDVSGSCNLPAVIFFFPQKDKMVCGKPGAKWVQFGMKILDNRNKKDSKP
    HHSGRRFFQGPQSGVRKLSSGTSRPLLLKFSGPTRSSKRKASLLTTAIPG
    P



    Гость /18.04.2007 07:01/
    mqvtfiyilv itcyendvnv yhiffqmslw lpseatvylp pvpvskvvst deyvartniy
    61 yhagtsrlla vghpyfpikk pnnnkilvpk vsglqyrvfr ihlpdpnkfg fpdtsfynpd
    121 tqrlvwacvg vevgrgqplg vgisghplln klddtenasa yaanagvdnr ecismdykqt
    181 qlcligckpp igehwgkgsp ctnvavnpgd cpplelintv iqdgdmvdtg fgamdfttlq
    241 anksevpldi ctsickypdy ikmvsepygd slffylrreq mfvrhlfnra gavgenvpdd
    301 lyikgsgsta nlassnyfpt psgsmvtsda qifnkpywlq raqghnngic wgnqlfvtvv
    361 dttrstnmsl caaistsett ykntnfkeyl rhgeeydlqf ifqlckitlt advmtyihsm
    421 nstiledwnf glqpppggtl edtyrfvtsq aiacqkhtpp apkedplkky tfwevnlkek
    481 fsadldqfpl grkfllqagl kakpkftlgk rkatpttsst sttakrkkrk l



    Гость /15.05.2007 23:14/
    MSSEGEIRTCFISARLPSWAGVRQGVAGTNVNGGVVGAPAQSGVLAYSRF
    VQQQQQQPGTAATGSVFRAVFPSVDLSAEVGMMRQALAELRQQLQELREV
    VEIQLRATASEAAEEEEEEEIVVDEEVAPGAGANTMEEEEDEMVLTMTVV
    GDPEPAGVEAQPPPPPTPESDPAVPATTTTPKRLSYGASKRSGPCAEDNV
    SGSGSGSGSGSGSGSGSGSGTVNQGAFEDCCLAYHSHIKWRLLRRAHSYQ
    RQDVSGSCNLPAVIFFFPQKDKMVCGKPGAKWVQFGMKILDNRNKKDSKP
    HHSGRRFFQGPQSGVRKLSSGTSRPLLLKFSGPTRSSKRKASLLTTAIPG



    Гость /22.05.2007 06:24/
    MVMFKKIKSF EVVFNDPEKV YGSGERVAGR VIVEVCEVTR VKAVRILACG
    VAKVLWMQGS QQCKQTSEYL RYEDTLLLED QPTGENEMVI MRPGNKYEYK
    FGFELPQGPL GTSFKGKYGC VDYWVKAFLD RPSQPTQETK KNFEVVDLVD
    VNTPDLMAPV SAKKEKKVSC MFIPDGRVSV SARIDRKGFC EGDEISIHAD
    FENTCSRIVV PKAAIVARHT YLANGQTKVL TQKLSSVRGN HIISGTCASW
    RGKSLRVQKI RPSILGCNIL RVEYSLLIYV SVPGSKKVIL DLPLVIGSRS
    GLSSRTSSMA SRTSSEMSWV DLNIPDTPEA PPCYMDVIPE DHRLESPTTP
    LLDDMDGSQD SPIFMYAPEF KFMPPPTYTE VDPCILNNNV Q



    Гость /05.06.2007 16:07/
    XSXSAazxsa



    Гость /10.06.2007 14:30/
    ATGAGTTCAGGCTTATGGAGCCAAGAAAA
    AGTCACTTCACCCTACTGGGAAGAGCGGATTTTTTACTTGCTTCTTCAAGAATGCAGCGT
    TACAGACAAACAAACACAAAAGCTCCTTAAAGTACCGAAGGGAAGTATAGGACAGTATAT
    TCAAGATCGTTCTGTGGGGCATTCAAGGATTCCTTCTGCAAAAGGCAAGAAAAATCAGAT
    TGGATTAAAAATTCTAGAGCAACCTCATGCAGTTCTCTTTGTTGATGAAAAGGATGTTGT
    AGAGATAAATGAAAAGTTCACAGAGTTACTTTTGGCAATTACCAATTGTGAGGAGAGGTT
    CAGCCTGTTTAAAAACAGAAACAGACTAAGTAAAGGCCTCCAAATAGACGTGGGCTGTCC
    TGTGAAAGTACAGCTGAGATCTGGGGAAGAAAAATTTCCTGGAGTTGTACGCTTCAGAGG
    ACCCCTGTTAGCAGAGAGGACAGTCTCCGGAATATTCTTTGGAGTTGAATTGCTGGAAGA
    AGGTCGTGGTCAAGGTTTCACTGACGGGGTGTACCAAGGGAAACAGCTTTTTCAGTGTGA
    TGAAGATTGTGGCGTGTTTGTTGCATTGGACAAGCTAGAACTCATAGAAGATGATGACAC
    TGCATTGGAAAGTGATTACGCAGGTCCTGGGGACACAATGCAGGTCGAACTTCCTCCTTT
    GGAAATAAACTCCAGAGTTTCTTTGAAGGTTGGAGAAACAATAGAATCTGGAACAGTTAT
    ATTCTGTGATGTTTTGCCAGGAAAAGAAAGCTTAGGATATTTTGTTGGTGTGGACATGGA
    TAACCCTATTGGCAACTGGGATGGAAGATTTGATGGAGTGCAGCTTTGTAGTTTTGCGTG
    TGTTGAAAGTACAATTCTATTGCACATCAATGATATCATCCCAGGTATGTTTTCTTTTGT
    GACGCAGGAAAGGAGGCCTCCCAAACTTGCCTTTATGTCAAGAGGTGTTGGGGACAAAGG
    TTCATCCAGTCATAATAAACCAAAGGCTACAGGATCTACCTCAGACCCTGGAAATAGAAA
    CAGATCTGAATTATTTTATACCTTAAATGGGTCTTCTGTTGACTCACAACCACAATCCAA
    ATCAAAAAATACATGGTACATTGATGAAGTTGCAGAAGACCCTGCAAAATCTCTTACAGA
    GATATCTACAGACTTTGACCGTTCTTCACCACCACTCCAGCCTCCTCCTGTGAACTCACT
    GACCACCGAGAACAGATTCCACTCTTTACCATTCAGTCTCACCAAGATGCCCAATACCAA
    TGGAAGTATTGGCCACAGTCCACTTTCTCTGTCAGCCCAGTCTGTAATGGAAGAGCTAAA
    CACTGCACCCGTCCAAGAGAGTCCACCCTTGGCCATGCCTCCTGGGAACTCACATGGTCT
    AGAAGTGGGCTCATTGGCTGAAGTTAAGGAGAACCCTCCTTTCTATGGGGTAATCCGTTG
    GATCGGTCAGCCACCAGGACTGAATGAAGTGCTCGCTGGACTGGAACTGGAAGATGAGTG
    TGCAGGCTGTACGGATGGAACCTTCAGAGGCACTCGGTATTTCACCTGTGCCCTGAAGAA
    GGCGCTGTTTGTGAAACTGAAGAGCTGCAGGCCTGACTCTAGGTTTGCATCATTGCAGCC
    GGTTTCCAATCAGATTGAGCGCTGTAACTCTTTAGCATTTGGAGGCTACTTAAGTGAAGT
    AGTAGAAGAAAATACTCCACCAAAAATGGAAAAAGAAGGCTTGGAGATAATGATTGGGAA
    GAAGAAAGGCATCCAGGGTCATTACAATTCTTGTTACTTAGACTCAACCTTATTCTGCTT
    ATTTGCTTTTAGTTCTGTTCTGGACACTGTGTTACTTAGACCCAAAGAAAAGAACGATGT
    AGAATATTATAGTGAAACCCAAGAGCTACTGAGGACAGAAATTGTTAATCCTCTGAGAAT
    ATATGGATATGTGTGTGCCACAAAAATTATGAAACTGAGGAAAATACTTGAAAAGGTGGA
    GGCTGCATCAGGATTTACCTCTGAAGAAAAAGATCCTGAGGAATTCTTGAATATTCTGTT
    TCATCATATTTTAAGGGTAGAACCTTTGCTAAAAATAAGATCAGCAGGTCAAAAGGTACA
    AGATTGTTACTTCTATCAAATTTTTATGGAAAAAAATGAGAAAGTTGGCGTTCCCACAAT
    TCAGCAGTTGTTAGAATGGTCTTTTATCAACAGTAACCTGAAATTTGCAGAGGCACCATC
    ATGTCTGATTATTCAGATGCCTCGATTTGGAAAAGACTTTAAACTATTTAAAAAAATTTT
    TCCTTCTCTGGAATTAAATATAACAGATTTACTTGAAGACACTCCCAGACAGTGCCGGAT
    ATGTGGAGGGCTTGCAATGTATGAGTGTAGAGAATGCTACGACGATCCGGACATCTCAGC
    TGGAAAAATCAAGCAGTTTTGTAAAACCTGCAACACTCAAGTCCACCTTCATCCGAAGAG
    GCTGAATCATAAATATAACCCAGTGTCACTTCCCAAAGACTTACCCGACTGGGACTGGAG
    ACACGGCTGCATCCCTTGCCAGAATATGGAGTTATTTGCTGTTCTCTGCATAGAAACAAG
    CCACTATGTTGCTTTTGTGAAGTATGGGAAGGACGATTCTGCCTGGCTCTTCTTTGACAG
    CATGGCCGATCGGGATGGTGGTCAGAATGGCTTCAACATTCCTCAAGTCACCCCATGCCC
    AGAAGTAGGAGAGTACTTGAAGATGTCTCTGGAAGACCTGCATTCCTTGGACTCCAGGAG
    AATCCAAGGCTGTGCACGAAGACTGCTTTGTGATGCATATATGTGCATGTACCAGAGTCC
    AACAATGAGTTTGTACAAA



    Гость /09.07.2007 09:52/
    mtriltackv vktlksgfgl anvtskrqwd fsrpgirlls vkaqtahivl edgtkmkgys
    61 fghpssvage vvfntglggy sealtdpayk gqiltmanpi ignggapdtt ardelglnky
    121 mesdgikvag llvlnyshdy nhwlatkslg qwlqeekvpa iygvdtrmlt kiirdkgtml
    181 gkiefegqsv dfvdpnkqnl iaevstkdvk vfgkgnptkv vavdcgiknn virllvkrga
    241 evhlvpwnhd ftqmdydgll iaggpgnpal aqpliqnvkk ilesdrkepl fgistgniit
    301 glaagaksyk msmanrgqnq pvlnitnrqa fitaqnhgya ldntlpagwk plfvnvndqt
    361 negimheskp ffavqfhpev spgptdteyl fdsffslikk gkgttitsvl pkpalvasrv
    421 evskvlilgs gglsigqage fdysgsqavk amkeenvktv lmnpniasvq tnevglkqad
    481 avyflpitpq fvtevikaer pdglilgmgg qtalncgvel fkrgvlkeyg vkvlgtsves
    541 imatedrqlf sdklneinek iapsfavesm edalkaadti gypvmirsay algglgsgic
    601 pnketlmdlg tkafamtnqi lversvtgwk eieyevvrda ddncvtvcnm envdamgvht
    661 gdsvvvapaq tlsnaefqml rrtsinvvrh lgivgecniq falhptsmey ciievnarls
    721 rssalaskat gyplafiaak ialgiplpei knvvsgktsa cfepsldymv tkiprwdldr
    781 fhgtssrigs smksvgevma igrtfeesfq kalrmchpsv dgftprlpmn kewpanldlr
    841 kelsepsstr iyaiakalen nmsldeivkl tsidkwflyk mrdilnmdkt lkglnsesvt
    901 eetlrqakei gfsdkqiskc lglteaqtre lrlkknihpw vkqidtlaae ypsvtnylyv
    961 tyngqehdik fdehgimvlg cgpyhigssv efdwcavssi rtlrqlgkkt vvvncnpetv
    1021 stdfdecdkl yfeelsleri ldiyhqeacn gciisvggqi pnnlavplyk ngvkimgtsp
    1081 lqidraedrs ifsavldelk vaqapwkavn tlnealefan svgypcllrp syvlsgsamn
    1141 vvfsedemkr fleeatrvsq ehpvvltkfi egarevemda vgkegrvish aisehvedag
    1201 vhsgdatlml ptqtisqgai ekvkdatrki akafaisgpf nvqflvkgnd vlviecnlra
    1261 srsfpfvskt lgvdfidvat kvmigesvde khlptleqpi ipsdyvaika pmfswprlrd
    1321 adpilrcema stgevacfge gihtaflkam lstgfkipqk giligiqqsf rprflgvaeq
    1381 lhnegfklfa teatsdwlna nnvpatpvaw psqegqnpsl ssirklirdg sidlvinlpn
    1441 nntkfvhdny virrtavdsg ialltnfqvt klfaeavqka rtvdskslfh yrqysagkaa
    //



    Гость /09.07.2007 09:54/
    mtriltackv vktlksgfgl anvtskrqwd fsrpgirlls vkaqtahivl edgtkmkgys fghpssvage vvfntglggy sealtdpayk gqiltmanpi ignggapdtt ardelglnky
    mesdgikvag llvlnyshdy nhwlatkslg qwlqeekvpa iygvdtrmlt kiirdkgtml gkiefegqsv dfvdpnkqnl iaevstkdvk vfgkgnptkv vavdcgiknn virllvkrga
    evhlvpwnhd ftqmdydgll iaggpgnpal aqpliqnvkk ilesdrkepl fgistgniit glaagaksyk msmanrgqnq pvlnitnrqa fitaqnhgya ldntlpagwk plfvnvndqt
    negimheskp ffavqfhpev spgptdteyl fdsffslikk gkgttitsvl pkpalvasrv evskvlilgs gglsigqage fdysgsqavk amkeenvktv lmnpniasvq tnevglkqad
    avyflpitpq fvtevikaer pdglilgmgg qtalncgvel fkrgvlkeyg vkvlgtsves imatedrqlf sdklneinek iapsfavesm edalkaadti gypvmirsay algglgsgic
    pnketlmdlg tkafamtnqi lversvtgwk eieyevvrda ddncvtvcnm envdamgvht gdsvvvapaq tlsnaefqml rrtsinvvrh lgivgecniq falhptsmey ciievnarls
    rssalaskat gyplafiaak ialgiplpei knvvsgktsa cfepsldymv tkiprwdldr fhgtssrigs smksvgevma igrtfeesfq kalrmchpsv dgftprlpmn kewpanldlr
    kelsepsstr iyaiakalen nmsldeivkl tsidkwflyk mrdilnmdkt lkglnsesvt eetlrqakei gfsdkqiskc lglteaqtre lrlkknihpw vkqidtlaae ypsvtnylyv
    tyngqehdik fdehgimvlg cgpyhigssv efdwcavssi rtlrqlgkkt vvvncnpetv stdfdecdkl yfeelsleri ldiyhqeacn gciisvggqi pnnlavplyk ngvkimgtsp
    lqidraedrs ifsavldelk vaqapwkavn tlnealefan svgypcllrp syvlsgsamn vvfsedemkr fleeatrvsq ehpvvltkfi egarevemda vgkegrvish aisehvedag
    vhsgdatlml ptqtisqgai ekvkdatrki akafaisgpf nvqflvkgnd vlviecnlra srsfpfvskt lgvdfidvat kvmigesvde khlptleqpi ipsdyvaika pmfswprlrd
    adpilrcema stgevacfge gihtaflkam lstgfkipqk giligiqqsf rprflgvaeq lhnegfklfa teatsdwlna nnvpatpvaw psqegqnpsl ssirklirdg sidlvinlpn
    nntkfvhdny virrtavdsg ialltnfqvt klfaeavqka rtvdskslfh yrqysagkaa



    Гость /20.07.2007 21:46/
    can you show the exact calculations on how to get the molar concentration of proteins?

    Thank you!



    Гость /25.07.2007 05:26/
    thank very nice



    Гость /20.08.2007 15:41/
    1 vpirkvqddt ktliktivtr indishtqsv sskqrvtgld fipglhplls lskmdqtlai
    61 yqqilaslps rnviqisndl enlrdllhll aaskscplpq vraleslesl gvvleaslys
    121 tevvalsrlq gslqdmlrql dlspgc



    Гость /21.08.2007 21:36/
    It's very nice, thank you!!



    Гость /07.01.2008 12:45/
    thaks a lot



    Гость /08.01.2008 22:19/
    Very usful site. Happy New Year, guys.



    Гость /12.01.2008 15:34/
    100/188.2



    Гость /07.02.2008 23:55/
    thanks very much -will be back



    Гость /15.02.2008 16:39/
    I'm a stranger when it comes to protein chemistry. The basics are therefore unfamiliar. Could someone explain please how come that when I calculate the molarity of 1g/l of a 33,5 kDa protein solution "by hand" I get roughly 30 mM, the program here gives me 30 uM. What am I missing?
    Thanks in advance!



    Гость /18.02.2008 17:12/
    Maybe you forgot that 33,5 kDa means 33500 Da.



    Гость /06.03.2008 09:54/
    MGTMAAGSITTLPALPEDGPSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
    RVDGVREKSDPHIKLQLQAEERGVVSIKGLCANRYLAMKEDGRLLASKCV
    TDECFFFERLESNNYNTYRSRKYTSWYVAIKENWAVQARK*NGSRAESHF
    ILTNVSQEL



    Гость /10.05.2008 01:42/
    This site is great!



    Гость /10.05.2008 01:42/
    This site is great!



    Гость /17.05.2008 03:41/
    VSDQRLSEATLRELEDERQRAGLPEKPEIPEGWTIDRKPGVTHFTMRKSHGDEEIILQLTGEDRSNEEITRTLDVLVVNGGKALVFGMSVEDGEFVINNV
    CFRHDGKLALDTSAEAQFQKSQLYMGPDLADLEDHLVDSFTSYLSARGVNDTLANFIDQFSLWSEQADYEEWLSSINKFVS



    Гость /11.06.2008 17:47/
    You are very halpful!



    Гость /19.06.2008 03:11/
    spacebo



    Гость /07.07.2008 18:24/
    RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC



    Гость /10.07.2008 13:17/
    cheers mate, useful indeed
    Alex



    Гость /14.07.2008 12:10/
    thanks a lot , this site is really good ,

    cheers
    phd student



    Гость /02.09.2008 23:09/
    YPYDVPDYA



    Гость /08.09.2008 17:02/
    YPYDVPDYA



    Гость /24.10.2008 22:49/
    GREAT!



    Гость /05.11.2008 19:32/
    svegegeeegee



    Гость /03.12.2008 17:13/
    ATGAGTTCAGGCTTATGGAGCCAAGAAAA
    AGTCACTTCACCCTACTGGGAAGAGCGGATTTTTTACTTGCTTCTTCAAGAATGCAGCGT
    TACAGACAAACAAACACAAAAGCTCCTTAAAGTACCGAAGGGAAGTATAGGACAGTATAT
    TCAAGATCGTTCTGTGGGGCATTCAAGGATTCCTTCTGCAAAAGGCAAGAAAAATCAGAT
    TGGATTAAAAATTCTAGAGCAACCTCATGCAGTTCTCTTTGTTGATGAAAAGGATGTTGT
    AGAGATAAATGAAAAGTTCACAGAGTTACTTTTGGCAATTACCAATTGTGAGGAGAGGTT
    CAGCCTGTTTAAAAACAGAAACAGACTAAGTAAAGGCCTCCAAATAGACGTGGGCTGTCC
    TGTGAAAGTACAGCTGAGATCTGGGGAAGAAAAATTTCCTGGAGTTGTACGCTTCAGAGG
    ACCCCTGTTAGCAGAGAGGACAGTCTCCGGAATATTCTTTGGAGTTGAATTGCTGGAAGA
    AGGTCGTGGTCAAGGTTTCACTGACGGGGTGTACCAAGGGAAACAGCTTTTTCAGTGTGA
    TGAAGATTGTGGCGTGTTTGTTGCATTGGACAAGCTAGAACTCATAGAAGATGATGACAC
    TGCATTGGAAAGTGATTACGCAGGTCCTGGGGACACAATGCAGGTCGAACTTCCTCCTTT
    GGAAATAAACTCCAGAGTTTCTTTGAAGGTTGGAGAAACAATAGAATCTGGAACAGTTAT
    ATTCTGTGATGTTTTGCCAGGAAAAGAAAGCTTAGGATATTTTGTTGGTGTGGACATGGA
    TAACCCTATTGGCAACTGGGATGGAAGATTTGATGGAGTGCAGCTTTGTAGTTTTGCGTG
    TGTTGAAAGTACAATTCTATTGCACATCAATGATATCATCCCAGGTATGTTTTCTTTTGT
    GACGCAGGAAAGGAGGCCTCCCAAACTTGCCTTTATGTCAAGAGGTGTTGGGGACAAAGG
    TTCATCCAGTCATAATAAACCAAAGGCTACAGGATCTACCTCAGACCCTGGAAATAGAAA
    CAGATCTGAATTATTTTATACCTTAAATGGGTCTTCTGTTGACTCACAACCACAATCCAA
    ATCAAAAAATACATGGTACATTGATGAAGTTGCAGAAGACCCTGCAAAATCTCTTACAGA
    GATATCTACAGACTTTGACCGTTCTTCACCACCACTCCAGCCTCCTCCTGTGAACTCACT
    GACCACCGAGAACAGATTCCACTCTTTACCATTCAGTCTCACCAAGATGCCCAATACCAA
    TGGAAGTATTGGCCACAGTCCACTTTCTCTGTCAGCCCAGTCTGTAATGGAAGAGCTAAA
    CACTGCACCCGTCCAAGAGAGTCCACCCTTGGCCATGCCTCCTGGGAACTCACATGGTCT
    AGAAGTGGGCTCATTGGCTGAAGTTAAGGAGAACCCTCCTTTCTATGGGGTAATCCGTTG
    GATCGGTCAGCCACCAGGACTGAATGAAGTGCTCGCTGGACTGGAACTGGAAGATGAGTG
    TGCAGGCTGTACGGATGGAACCTTCAGAGGCACTCGGTATTTCACCTGTGCCCTGAAGAA
    GGCGCTGTTTGTGAAACTGAAGAGCTGCAGGCCTGACTCTAGGTTTGCATCATTGCAGCC
    GGTTTCCAATCAGATTGAGCGCTGTAACTCTTTAGCATTTGGAGGCTACTTAAGTGAAGT
    AGTAGAAGAAAATACTCCACCAAAAATGGAAAAAGAAGGCTTGGAGATAATGATTGGGAA
    GAAGAAAGGCATCCAGGGTCATTACAATTCTTGTTACTTAGACTCAACCTTATTCTGCTT
    ATTTGCTTTTAGTTCTGTTCTGGACACTGTGTTACTTAGACCCAAAGAAAAGAACGATGT
    AGAATATTATAGTGAAACCCAAGAGCTACTGAGGACAGAAATTGTTAATCCTCTGAGAAT
    ATATGGATATGTGTGTGCCACAAAAATTATGAAACTGAGGAAAATACTTGAAAAGGTGGA
    GGCTGCATCAGGATTTACCTCTGAAGAAAAAGATCCTGAGGAATTCTTGAATATTCTGTT
    TCATCATATTTTAAGGGTAGAACCTTTGCTAAAAATAAGATCAGCAGGTCAAAAGGTACA
    AGATTGTTACTTCTATCAAATTTTTATGGAAAAAAATGAGAAAGTTGGCGTTCCCACAAT
    TCAGCAGTTGTTAGAATGGTCTTTTATCAACAGTAACCTGAAATTTGCAGAGGCACCATC
    ATGTCTGATTATTCAGATGCCTCGATTTGGAAAAGACTTTAAACTATTTAAAAAAATTTT
    TCCTTCTCTGGAATTAAATATAACAGATTTACTTGAAGACACTCCCAGACAGTGCCGGAT
    ATGTGGAGGGCTTGCAATGTATGAGTGTAGAGAATGCTACGACGATCCGGACATCTCAGC
    TGGAAAAATCAAGCAGTTTTGTAAAACCTGCAACACTCAAGTCCACCTTCATCCGAAGAG
    GCTGAATCATAAATATAACCCAGTGTCACTTCCCAAAGACTTACCCGACTGGGACTGGAG
    ACACGGCTGCATCCCTTGCCAGAATATGGAGTTATTTGCTGTTCTCTGCATAGAAACAAG
    CCACTATGTTGCTTTTGTGAAGTATGGGAAGGACGATTCTGCCTGGCTCTTCTTTGACAG
    CATGGCCGATCGGGATGGTGGTCAGAATGGCTTCAACATTCCTCAAGTCACCCCATGCCC
    AGAAGTAGGAGAGTACTTGAAGATGTCTCTGGAAGACCTGCATTCCTTGGACTCCAGGAG
    AATCCAAGGCTGTGCACGAAGACTGCTTTGTGATGCATATATGTGCATGTACCAGAGTCC
    AACAATGAGTTTGTACAAA



    Гость /15.01.2009 15:50/
    nice one amazing



    Гость /27.01.2009 17:09/
    mgrrdaqllaallvlglcalagsekpspcqcsrlsphnrtncgfpgitsdqcfdngccfdssvtgvpwcfhplpkqesdqcvmevsdrrncgypgispee
    casrkccfsnfifevpwcffpksvedchy



    Гость /20.03.2009 06:33/
    MGGLAMEEMPLSVLFEQARKIHLAASESGVDQDVVKKGCEMFQKCEDMIGKLALFSSNET
    KEDISTNNLKYLLVPYYLAELTEKIIQEDRIQIVKASYAKLKEFFSFCEAMELVPDEELE
    ASSRGGSGAPADRRALKIARFKRQKAAEAKLLEIKERKERRGRSTKASALSTPVESGEDD
    IPDDDSEEEREAWLSSINLAICKAIDLLEMLKREEEMLSAIKERQLKDGEGGFSRDALDD
    RTKKAETWHRDAAARIQYSKPAQPITCATFAQDVLEGRASVSQGHEHKNQPLIFGPASIV
    GGPLSTERERMIAQVFQPSHRMPTMCIEDAGLTEMNIMNDWQEQTKKAIEEATTSWYNDK
    PLRRKEEDEEDDDEDEEAVMKARAFDDWKDDNPRGAGNKKLTPCG



    Гость /02.04.2009 06:32/
    spacebo bolshoe



    Гость /06.04.2009 06:58/
    1 mgsqqvaisf ltnlakaafg lgvaatalns slytvdgger avlfdrfrgv ldqtvgegth
    61 flipylqtph iydirtkpht fssksgtkdl qmvnltlrvl frpevsrlpy ifqtlgleyd
    121 ekvlpsigne vlkavvanfn adqllterpq vsalvrdali krarefniel ddiaithlsy
    181 gaefsravea kqvaqqeaer skfvvmkadq erraavirae geseaaqlis datakagmgl
    241 ielrrieasr evaatlarsp nvaylpggqs mlfnlnpgr








       


See also:
/web-links/
Last modification: 30/07/13

MAIN PAGE · PROJECT · PROTOCOLS · PROGRAMS · LITERATURE · WEB · COMPANIES · MARKETPLACE · CLASSIFIED · FORUMS ·

 ·  Викимарт - все интернет-магазины в одном месте  ·  Доска объявлений Board.com.ua  · 
--- сервер арендован в компании Hetzner Online, Германия ---
--- администрирование сервера: Intervipnet ---

zbio.net  ·  editor@zbio.net  ·  advertizing

molbiol.ru - методы, информация и программы для молекулярных биологов   Rambler